PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527294.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 233aa    MW: 25541.1 Da    PI: 10.5034
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527294.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.5e-1489134247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT eE+  ++ + k lG+g+W+ I+r++ ++Rt+ q+ s+ qky
   XP_010527294.1  89 KPWTVEEHRTFLAGLKNLGKGDWRGISRKFVTTRTPTQVASHAQKY 134
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.548821IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129415.98483139IPR017930Myb domain
SuperFamilySSF466894.86E-1684139IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1587138IPR006447Myb domain, plants
SMARTSM007179.0E-1087137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1089134IPR009057Homeodomain-like
PfamPF002499.1E-1189134IPR001005SANT/Myb domain
CDDcd001671.48E-890135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MVTAAKTCSR CGLDGHNART CVNGVNKPCV KLFGVNISDP TPFGTPLRKS LSMGNLPSLA  60
VKPAEDEPGY HSDGLTGCKK RRASRKTGKP WTVEEHRTFL AGLKNLGKGD WRGISRKFVT  120
TRTPTQVASH AQKYFIRKNN NNQRKRRASL FDIPLDDSSE GNNTDQAWTV APPTPETLAE  180
GLAQFNVLNQ CRNPSMFPQV FRYASAVPVQ MVHPSGIPVP RYIPTGIPPS QAD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7773741e-145KC777374.1 Cleome spinosa KUOX1-like (At5g07480-like), hypothetical protein (At5g07490-like), and myb-like (At5g61620-like) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527294.11e-175PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B05e-27MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLT1SFV41e-175T1SFV4_9R
STRINGAT5G61620.11e-78(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.12e-75MYB_related family protein